Notice (8) : file_put_contents(): Write of 271 bytes failed with errno=28 No space left on device [CORE/src/Log/Engine/FileLog.php , line 140 ]Code Context if (! $mask ) {
file_put_contents ( $pathname , $message . "\n" , FILE_APPEND );
file_put_contents - [internal], line ??
Cake\Log\Engine\FileLog::log() - CORE/src/Log/Engine/FileLog.php, line 140
Cake\Log\Log::write() - CORE/src/Log/Log.php, line 392
Cake\Log\Log::warning() - CORE/src/Log/Log.php, line 477
DebugKit\ToolbarService::isSuspiciouslyProduction() - ROOT/vendor/cakephp/debug_kit/src/ToolbarService.php, line 169
DebugKit\ToolbarService::isEnabled() - ROOT/vendor/cakephp/debug_kit/src/ToolbarService.php, line 105
DebugKit\Plugin::bootstrap() - ROOT/vendor/cakephp/debug_kit/src/Plugin.php, line 48
Cake\Http\BaseApplication::pluginBootstrap() - CORE/src/Http/BaseApplication.php, line 182
Cake\Http\Server::bootstrap() - CORE/src/Http/Server.php, line 111
Cake\Http\Server::run() - CORE/src/Http/Server.php, line 79
[main] - ROOT/webroot/index.php, line 40
Notice : file_put_contents() [function.file-put-contents ]: Write of 1105 bytes failed with errno=28 No space left on device in /www/wwwroot/kangbaba.com/vendor/cakephp/cakephp/src/Log/Engine/FileLog.php on line 140
Notice (8) : file_put_contents() [<a href='https://secure.php.net/function.file-put-contents'>function.file-put-contents</a>]: Write of 6531 bytes failed with errno=28 No space left on device [CORE/src/Log/Engine/FileLog.php , line 140 ]Code Context if (! $mask ) {
file_put_contents ( $pathname , $message . "\n" , FILE_APPEND );
file_put_contents - [internal], line ??
Cake\Log\Engine\FileLog::log() - CORE/src/Log/Engine/FileLog.php, line 140
Cake\Log\Log::write() - CORE/src/Log/Log.php, line 392
Cake\Log\Log::error() - CORE/src/Log/Log.php, line 461
Cake\Error\ErrorLogger::log() - CORE/src/Error/ErrorLogger.php, line 91
Cake\Error\BaseErrorHandler::logException() - CORE/src/Error/BaseErrorHandler.php, line 334
Cake\Error\Middleware\ErrorHandlerMiddleware::handleException() - CORE/src/Error/Middleware/ErrorHandlerMiddleware.php, line 147
Cake\Error\Middleware\ErrorHandlerMiddleware::process() - CORE/src/Error/Middleware/ErrorHandlerMiddleware.php, line 130
Cake\Http\Runner::handle() - CORE/src/Http/Runner.php, line 73
Cake\Http\Runner::run() - CORE/src/Http/Runner.php, line 58
Cake\Http\Server::run() - CORE/src/Http/Server.php, line 90
[main] - ROOT/webroot/index.php, line 40
Error: Missing Database Connection
Connection to Mysql could not be established: SQLSTATE[HY000] [1040] Too many connections
$retry = new CommandRetry (new ErrorCodeWaitStrategy (static:: RETRY_ERROR_CODES , 5 ), 4 );
try {
$retry -> run ( $action );
} catch ( PDOException $e ) {
throw new MissingConnectionException (
[
'driver' => App :: shortName (static::class, 'Database/Driver' ),
'reason' => $e -> getMessage (),
],
Arguments
if (!empty( $config [ 'encoding' ])) {
$dsn .= ";charset= { $config [ 'encoding' ]} " ;
}
$this -> _connect ( $dsn , $config );
if (!empty( $config [ 'init' ])) {
$connection = $this -> getConnection ();
foreach ((array) $config [ 'init' ] as $command ) {
Arguments
'mysql:host=localhost;port=3306;dbname=mulus;charset=utf8mb4'
[
'driver' => 'Cake\Database\Driver\Mysql' ,
'persistent' => false ,
'timezone' => '+0:00' ,
'flags' => [
(int) 12 => false ,
(int) 1000 => true ,
(int) 3 => (int) 2 ,
] ,
'cacheMetadata' => true ,
'log' => false ,
'quoteIdentifiers' => false ,
'host' => 'localhost' ,
'username' => 'mulus' ,
'password' => 'f3tCPCisE7WLPCh7' ,
'database' => 'mulus' ,
'url' => null ,
'name' => 'default' ,
'port' => '3306' ,
'encoding' => 'utf8mb4' ,
'init' => [
(int) 0 => 'SET time_zone = '+0:00'' ,
] ,
]
* @ param \Cake\Database\DriverInterface $driver The driver to use.
*/
public function __construct ( DriverInterface $driver )
{
$driver -> connect ();
$this -> _driver = $driver ;
}
/**
*/
public function schemaDialect (): SchemaDialect
{
if ( $this -> _schemaDialect === null ) {
$this -> _schemaDialect = new MysqlSchemaDialect ( $this );
}
return $this -> _schemaDialect ;
}
Arguments
object( Cake\Database\Driver\Mysql ) id: 0 {
'connected' => false
}
*/
public function __construct ( Connection $connection )
{
$this -> _connection = $connection ;
$this -> _dialect = $connection -> getDriver ()-> schemaDialect ();
}
/**
* Get the list of tables available in the current connection .
}
if (!empty( $this -> _config [ 'cacheMetadata' ])) {
return $this -> _schemaCollection = new CachedCollection (
new SchemaCollection ( $this ),
empty( $this -> _config [ 'cacheKeyPrefix' ]) ? $this -> configName () : $this -> _config [ 'cacheKeyPrefix' ],
$this -> getCacher ()
);
}
Arguments
object( Cake\Database\Connection ) id: 0 {
'config' => [
'password' => '*****' ,
'username' => '*****' ,
'host' => '*****' ,
'database' => '*****' ,
'driver' => 'Cake\Database\Driver\Mysql' ,
'persistent' => false ,
'timezone' => 'UTC' ,
'flags' => [
] ,
'cacheMetadata' => true ,
'log' => false ,
'quoteIdentifiers' => false ,
'url' => null ,
'name' => 'default' ,
]
'driver' => object( Cake\Database\Driver\Mysql ) id: 1 {
'connected' => false
}
'transactionLevel' => (int) 0
'transactionStarted' => false
'useSavePoints' => false
'logQueries' => false
'logger' => null
}
{
if ( $this -> _schema === null ) {
$this -> _schema = $this -> _initializeSchema (
$this -> getConnection ()
-> getSchemaCollection ()
-> describe ( $this -> getTable ())
);
if ( Configure :: read ( 'debug' )) {
$this -> checkAliasLengths ();
*/
public function addDefaultTypes ( Table $table )
{
$alias = $table -> getAlias ();
$map = $table -> getSchema ()-> typeMap ();
$fields = [];
foreach ( $map as $f => $type ) {
$fields [ $f ] = $fields [ $alias . '.' . $f ] = $fields [ $alias . '__' . $f ] = $type ;
}
parent :: __construct ( $connection );
$this -> repository ( $table );
if ( $this -> _repository !== null ) {
$this -> addDefaultTypes ( $this -> _repository );
}
}
/**
Arguments
object( App\Model\Table\navsTable ) id: 0 {
'registryAlias' => 'Navs'
'table' => 'navs'
'alias' => 'Navs'
'entityClass' => 'Cake\ORM\Entity'
'associations' => [
(int) 0 => 'Domains' ,
]
'behaviors' => [
]
'defaultConnection' => 'default'
'connectionName' => 'default'
}
* @return \Cake\ORM\Query
*/
public function query (): Query
{
return new Query ( $this -> getConnection (), $this );
}
/**
* Creates a new Query :: subquery () instance for a table .
Arguments
object( Cake\Database\Connection ) id: 0 {
'config' => [
'password' => '*****' ,
'username' => '*****' ,
'host' => '*****' ,
'database' => '*****' ,
'driver' => 'Cake\Database\Driver\Mysql' ,
'persistent' => false ,
'timezone' => 'UTC' ,
'flags' => [
] ,
'cacheMetadata' => true ,
'log' => false ,
'quoteIdentifiers' => false ,
'url' => null ,
'name' => 'default' ,
]
'driver' => object( Cake\Database\Driver\Mysql ) id: 1 {
'connected' => false
}
'transactionLevel' => (int) 0
'transactionStarted' => false
'useSavePoints' => false
'logQueries' => false
'logger' => null
}
object( App\Model\Table\navsTable ) id: 0 {
'registryAlias' => 'Navs'
'table' => 'navs'
'alias' => 'Navs'
'entityClass' => 'Cake\ORM\Entity'
'associations' => [
(int) 0 => 'Domains' ,
]
'behaviors' => [
]
'defaultConnection' => 'default'
'connectionName' => 'default'
}
* @return \Cake\ORM\Query The query builder
*/
public function find ( string $type = 'all' , array $options = []): Query
{
$query = $this -> query ();
$query -> select ();
return $this -> callFinder ( $type , $query , $options );
}
$recentArticles = $this -> fetchTable ( $table_name )-> find ( 'all' , $where_ )-> contain ( $belongsTo )-> all ();;
}
else
{
$recentArticles = $this -> fetchTable ( $table_name )-> find ( 'all' , $where_ )-> all ();
}
$return = $this -> object2array ( $recentArticles );
}
Arguments
[
'conditions' => [
'domain_id' => (int) 9 ,
] ,
'order' => 'title_showid asc' ,
]
set_time_limit ( 240 ); //4minutes
ini_set ( 'memory_limit' , '512M' );
date_default_timezone_set ( 'PRC' );
$abc = $this -> action_ ( $array , $is_http = 1 );
$show =array();
$show [ "code" ]= 200 ;
$show [ "data" ]= $abc ;
Arguments
[
'table_name' => 'Navs' ,
'cache_folder' => 'long' ,
'where' => [
'domain_id' => (int) 9 ,
] ,
'order' => 'title_showid asc' ,
'Async' => (int) 0 ,
'cache_cache_file_name' => 'b876b651785c2bf522517ba8b313ff1d' ,
]
// echo "<br>======2======<br>\n";
// echo "不存在/";
$file = $this -> $action ( $array );
if ( $file [ "code" ]== 200 and is_array ( $file [ "data" ]))
{
//获取数据成功!
Arguments
[
'table_name' => 'Navs' ,
'cache_folder' => 'long' ,
'where' => [
'domain_id' => (int) 9 ,
] ,
'order' => 'title_showid asc' ,
'Async' => (int) 0 ,
'cache_cache_file_name' => 'b876b651785c2bf522517ba8b313ff1d' ,
]
{
date_default_timezone_set ( 'PRC' );
$file = $this -> action_cache ( $get_data );
if ( $file [ "code" ]== 200 )
{
$match = $file [ "data" ];
Arguments
[
'table_name' => 'Navs' ,
'cache_folder' => 'long' ,
'where' => [
'domain_id' => (int) 9 ,
] ,
'order' => 'title_showid asc' ,
'Async' => (int) 0 ,
'cache_cache_file_name' => 'b876b651785c2bf522517ba8b313ff1d' ,
]
$get_data [ "cache_folder" ]= "long" ;
$where [ "domain_id" ]= id ;
$get_data [ "where" ]= $where ;
$get_data [ "order" ]= "title_showid asc" ;
$content1 = $this -> cache_action ( $get_data );
//查出相应的文章分类信息
$sort_name = "" ;
Arguments
[
'table_name' => 'Navs' ,
'cache_folder' => 'long' ,
'where' => [
'domain_id' => (int) 9 ,
] ,
'order' => 'title_showid asc' ,
]
* @ throws \UnexpectedValueException If return value of action is not ` null ` or ` ResponseInterface ` instance .
*/
public function invokeAction ( Closure $action , array $args ): void
{
$result = $action (... $args );
if ( $result !== null && ! $result instanceof ResponseInterface ) {
throw new UnexpectedValueException ( sprintf (
'Controller actions can only return ResponseInterface instance or null. '
. 'Got %s instead.' ,
$args = $this -> getActionArgs (
$action ,
array_values ((array) $controller -> getRequest ()-> getParam ( 'pass' ))
);
$controller -> invokeAction ( $action , $args );
$result = $controller -> shutdownProcess ();
if ( $result instanceof ResponseInterface ) {
return $result ;
return $runner -> run ( $middlewareQueue , $controller -> getRequest (), $this );
}
return $this -> handle ( $controller -> getRequest ());
}
/**
* Invoke the action .
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
'csrfToken' => '51kGk5RUwiY8d6yJT101MNxM+SYlRk6OYx+6nlhzcwq4BbxrLJm+ic4Tx5Ik2EbCjimC3tYy0v2MLUcgTmvtlUHKApjKtGlQvy6cEBBwLOpSK4OvORBKM942jglK/N2+rXKkoBS6IvG3H7fvtQGzzQ==' ,
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
}
$controller = $this -> controllerFactory -> create ( $request );
return $this -> controllerFactory -> invoke ( $controller );
}
}
Arguments
object( App\Controller\HomeController ) id: 0 {
paginate => [
]
protected name => 'Home'
protected request => object( Cake\Http\ServerRequest ) id: 1 {
trustProxy => false
protected params => [
'' => [maximum depth reached] ,
]
protected data => [
'' => [maximum depth reached] ,
]
protected query => [
'' => [maximum depth reached] ,
]
protected cookies => [
'' => [maximum depth reached] ,
]
protected _environment => [
'' => [maximum depth reached] ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
'' => [maximum depth reached] ,
]
protected _detectors => [
'' => [maximum depth reached] ,
]
protected _detectorCache => [
'' => [maximum depth reached] ,
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 2 {
}
protected uri => object( Laminas\Diactoros\Uri ) id: 3 {
}
protected session => object( Cake\Http\Session ) id: 4 {
}
protected flash => object( Cake\Http\FlashMessage ) id: 5 {
}
protected attributes => [
'' => [maximum depth reached] ,
]
protected emulatedAttributes => [
'' => [maximum depth reached] ,
]
protected uploadedFiles => [
'' => [maximum depth reached] ,
]
protected protocol => null
protected requestTarget => null
}
protected response => object( Cake\Http\Response ) id: 6 {
'status' => (int) 200
'contentType' => 'text/html'
'headers' => [
'Content-Type' => [
'' => [maximum depth reached] ,
] ,
]
'file' => null
'fileRange' => [
]
'cookies' => object( Cake\Http\Cookie\CookieCollection ) id: 7 {
}
'cacheDirectives' => [
]
'body' => ''
}
protected autoRender => true
protected _components => null
protected plugin => null
protected middlewares => [
]
protected _eventManager => object( Cake\Event\EventManager ) id: 8 {
'_listeners' => [
'Controller.initialize' => '1 listener(s)' ,
'Controller.beforeRender' => '1 listener(s)' ,
'Controller.beforeRedirect' => '1 listener(s)' ,
'Controller.shutdown' => '1 listener(s)' ,
]
'_isGlobal' => false
'_trackEvents' => false
'_generalManager' => '(object) EventManager'
'_dispatchedEvents' => null
}
protected _eventClass => 'Cake\Event\Event'
protected defaultTable => 'Home'
protected _tableLocator => object( Cake\ORM\Locator\TableLocator ) id: 9 {
protected locations => [
'' => [maximum depth reached] ,
]
protected _config => [
'' => [maximum depth reached] ,
]
protected instances => [
'' => [maximum depth reached] ,
]
protected _fallbacked => [
'' => [maximum depth reached] ,
]
protected fallbackClassName => 'Cake\ORM\Table'
protected allowFallbackClass => false
protected options => [
'' => [maximum depth reached] ,
]
}
protected modelClass => 'Home'
protected _modelFactories => [
'Table' => [
(int) 0 => object( Cake\ORM\Locator\TableLocator ) id: 9 {} ,
(int) 1 => 'get' ,
] ,
]
protected _modelType => 'Table'
protected _viewBuilder => object( Cake\View\ViewBuilder ) id: 10 {
protected _templatePath => null
protected _template => null
protected _plugin => null
protected _theme => 'Index'
protected _layout => null
protected _autoLayout => true
protected _layoutPath => null
protected _name => null
protected _className => null
protected _options => [
'' => [maximum depth reached] ,
]
protected _helpers => [
'' => [maximum depth reached] ,
]
protected _vars => [
'' => [maximum depth reached] ,
]
}
}
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
}
$response = new Response ([
'body' => 'Middleware queue was exhausted without returning a response '
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
'csrfToken' => '51kGk5RUwiY8d6yJT101MNxM+SYlRk6OYx+6nlhzcwq4BbxrLJm+ic4Tx5Ik2EbCjimC3tYy0v2MLUcgTmvtlUHKApjKtGlQvy6cEBBwLOpSK4OvORBKM942jglK/N2+rXKkoBS6IvG3H7fvtQGzzQ==' ,
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $method === 'GET' && $cookieData === null ) {
$token = $this -> createToken ();
$request = $request -> withAttribute ( 'csrfToken' , $this -> saltToken ( $token ));
/** @var mixed $response */
$response = $handler -> handle ( $request );
return $this -> _addTokenCookie ( $token , $request , $response );
}
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
'csrfToken' => '51kGk5RUwiY8d6yJT101MNxM+SYlRk6OYx+6nlhzcwq4BbxrLJm+ic4Tx5Ik2EbCjimC3tYy0v2MLUcgTmvtlUHKApjKtGlQvy6cEBBwLOpSK4OvORBKM942jglK/N2+rXKkoBS6IvG3H7fvtQGzzQ==' ,
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $this -> queue -> valid ()) {
$middleware = $this -> queue -> current ();
$this -> queue -> next ();
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
'csrfToken' => '51kGk5RUwiY8d6yJT101MNxM+SYlRk6OYx+6nlhzcwq4BbxrLJm+ic4Tx5Ik2EbCjimC3tYy0v2MLUcgTmvtlUHKApjKtGlQvy6cEBBwLOpSK4OvORBKM942jglK/N2+rXKkoBS6IvG3H7fvtQGzzQ==' ,
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( Cake\Http\Runner ) id: 0 {
protected queue => object( Cake\Http\MiddlewareQueue ) id: 1 {
protected position => (int) 6
protected queue => [
'' => [maximum depth reached] ,
]
}
protected fallbackHandler => object( App\Application ) id: 2 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 3 {
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 4 {
}
protected container => object( Cake\Core\Container ) id: 5 {
}
protected _eventManager => object( Cake\Event\EventManager ) id: 6 {
}
protected _eventClass => 'Cake\Event\Event'
}
}
public function process ( ServerRequestInterface $request , RequestHandlerInterface $handler ): ResponseInterface
{
$locale = Locale :: acceptFromHttp ( $request -> getHeaderLine ( 'Accept-Language' ));
if (! $locale ) {
return $handler -> handle ( $request );
}
if ( $this -> locales !== [ '*' ]) {
$locale = Locale :: lookup ( $this -> locales , $locale , true );
}
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $this -> queue -> valid ()) {
$middleware = $this -> queue -> current ();
$this -> queue -> next ();
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( Cake\Http\Runner ) id: 0 {
protected queue => object( Cake\Http\MiddlewareQueue ) id: 1 {
protected position => (int) 6
protected queue => [
'' => [maximum depth reached] ,
]
}
protected fallbackHandler => object( App\Application ) id: 2 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 3 {
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 4 {
}
protected container => object( Cake\Core\Container ) id: 5 {
}
protected _eventManager => object( Cake\Event\EventManager ) id: 6 {
}
protected _eventClass => 'Cake\Event\Event'
}
}
*/
public function process ( ServerRequestInterface $request , RequestHandlerInterface $handler ): ResponseInterface
{
if (! in_array ( $request -> getMethod (), $this -> methods , true )) {
return $handler -> handle ( $request );
}
[ $type ] = explode ( ';' , $request -> getHeaderLine ( 'Content-Type' ));
$type = strtolower ( $type );
if (!isset( $this -> parsers [ $type ])) {
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $this -> queue -> valid ()) {
$middleware = $this -> queue -> current ();
$this -> queue -> next ();
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( Cake\Http\Runner ) id: 0 {
protected queue => object( Cake\Http\MiddlewareQueue ) id: 1 {
protected position => (int) 6
protected queue => [
'' => [maximum depth reached] ,
]
}
protected fallbackHandler => object( App\Application ) id: 2 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 3 {
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 4 {
}
protected container => object( Cake\Core\Container ) id: 5 {
}
protected _eventManager => object( Cake\Event\EventManager ) id: 6 {
}
protected _eventClass => 'Cake\Event\Event'
}
}
);
}
$matching = Router :: getRouteCollection ()-> getMiddleware ( $middleware );
if (! $matching ) {
return $handler -> handle ( $request );
}
$middleware = new MiddlewareQueue ( $matching );
$runner = new Runner ();
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $this -> queue -> valid ()) {
$middleware = $this -> queue -> current ();
$this -> queue -> next ();
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'pass' => [
] ,
'controller' => 'Home' ,
'action' => 'indexed' ,
'plugin' => null ,
'_matchedRoute' => '/indexed' ,
'?' => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
] ,
'_ext' => null ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( Cake\Http\Runner ) id: 0 {
protected queue => object( Cake\Http\MiddlewareQueue ) id: 1 {
protected position => (int) 6
protected queue => [
'' => [maximum depth reached] ,
]
}
protected fallbackHandler => object( App\Application ) id: 2 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 3 {
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 4 {
}
protected container => object( Cake\Core\Container ) id: 5 {
}
protected _eventManager => object( Cake\Event\EventManager ) id: 6 {
}
protected _eventClass => 'Cake\Event\Event'
}
}
public function process ( ServerRequestInterface $request , RequestHandlerInterface $handler ): ResponseInterface
{
$url = $request -> getUri ()-> getPath ();
if ( strpos ( $url , '..' ) !== false || strpos ( $url , '.' ) === false ) {
return $handler -> handle ( $request );
}
if ( strpos ( $url , '/.' ) !== false ) {
return $handler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'plugin' => null ,
'controller' => null ,
'action' => null ,
'_ext' => null ,
'pass' => [
] ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $this -> queue -> valid ()) {
$middleware = $this -> queue -> current ();
$this -> queue -> next ();
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'plugin' => null ,
'controller' => null ,
'action' => null ,
'_ext' => null ,
'pass' => [
] ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( Cake\Http\Runner ) id: 0 {
protected queue => object( Cake\Http\MiddlewareQueue ) id: 1 {
protected position => (int) 6
protected queue => [
'' => [maximum depth reached] ,
]
}
protected fallbackHandler => object( App\Application ) id: 2 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 3 {
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 4 {
}
protected container => object( Cake\Core\Container ) id: 5 {
}
protected _eventManager => object( Cake\Event\EventManager ) id: 6 {
}
protected _eventClass => 'Cake\Event\Event'
}
}
*/
public function process ( ServerRequestInterface $request , RequestHandlerInterface $handler ): ResponseInterface
{
try {
return $handler -> handle ( $request );
} catch ( RedirectException $exception ) {
return $this -> handleRedirect ( $exception );
} catch ( Throwable $exception ) {
return $this -> handleException ( $exception , $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'plugin' => null ,
'controller' => null ,
'action' => null ,
'_ext' => null ,
'pass' => [
] ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
if ( $this -> queue -> valid ()) {
$middleware = $this -> queue -> current ();
$this -> queue -> next ();
return $middleware -> process ( $request , $this );
}
if ( $this -> fallbackHandler ) {
return $this -> fallbackHandler -> handle ( $request );
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'plugin' => null ,
'controller' => null ,
'action' => null ,
'_ext' => null ,
'pass' => [
] ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( Cake\Http\Runner ) id: 0 {
protected queue => object( Cake\Http\MiddlewareQueue ) id: 1 {
protected position => (int) 6
protected queue => [
'' => [maximum depth reached] ,
]
}
protected fallbackHandler => object( App\Application ) id: 2 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 3 {
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 4 {
}
protected container => object( Cake\Core\Container ) id: 5 {
}
protected _eventManager => object( Cake\Event\EventManager ) id: 6 {
}
protected _eventClass => 'Cake\Event\Event'
}
}
$this -> queue = $queue ;
$this -> queue -> rewind ();
$this -> fallbackHandler = $fallbackHandler ;
return $this -> handle ( $request );
}
/**
* Handle incoming server request and return a response .
Arguments
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'plugin' => null ,
'controller' => null ,
'action' => null ,
'_ext' => null ,
'pass' => [
] ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
}
$this -> dispatchEvent ( 'Server.buildMiddleware' , [ 'middleware' => $middleware ]);
$response = $this -> runner -> run ( $middleware , $request , $this -> app );
if ( $request instanceof ServerRequest ) {
$request -> getSession ()-> close ();
}
Arguments
object( Cake\Http\MiddlewareQueue ) id: 0 {
protected position => (int) 6
protected queue => [
(int) 0 => object( Cake\Error\Middleware\ErrorHandlerMiddleware ) id: 1 {
} ,
(int) 1 => object( Cake\Routing\Middleware\AssetMiddleware ) id: 2 {
} ,
(int) 2 => object( Cake\Routing\Middleware\RoutingMiddleware ) id: 3 {
} ,
(int) 3 => object( Cake\Http\Middleware\BodyParserMiddleware ) id: 4 {
} ,
(int) 4 => object( Cake\I18n\Middleware\LocaleSelectorMiddleware ) id: 5 {
} ,
(int) 5 => object( Cake\Http\Middleware\CsrfProtectionMiddleware ) id: 6 {
} ,
]
}
object( Cake\Http\ServerRequest ) id: 0 {
trustProxy => false
protected params => [
'plugin' => null ,
'controller' => null ,
'action' => null ,
'_ext' => null ,
'pass' => [
] ,
]
protected data => [
]
protected query => [
'domain' => 'franks-taallergyspecialtypharmacynetwovika33.ru' ,
]
protected cookies => [
]
protected _environment => [
'USER' => 'www' ,
'HOME' => '/home/www' ,
'HTTP_X_FORWARDED_FOR' => '216.73.216.0' ,
'HTTP_X_FORWARDED_PROTO' => 'https' ,
'HTTP_CF_VISITOR' => '{"scheme":"https"}' ,
'HTTP_CF_IPCOUNTRY' => 'US' ,
'HTTP_CF_CONNECTING_IP' => '216.73.216.0' ,
'HTTP_CDN_LOOP' => 'cloudflare; loops=1' ,
'HTTP_USER_AGENT' => 'Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)' ,
'HTTP_ACCEPT_ENCODING' => 'gzip, br' ,
'HTTP_ACCEPT' => '*/*' ,
'HTTP_CF_RAY' => '971f1465c8de0010-ORD' ,
'HTTP_HOST' => 'www.ie0808.com' ,
'PATH_INFO' => '' ,
'REDIRECT_STATUS' => '200' ,
'SERVER_NAME' => 'kangbaba.com' ,
'SERVER_PORT' => '80' ,
'SERVER_ADDR' => '142.171.30.215' ,
'REMOTE_PORT' => '21422' ,
'REMOTE_ADDR' => '172.70.126.202' ,
'SERVER_SOFTWARE' => 'nginx/1.24.0' ,
'GATEWAY_INTERFACE' => 'CGI/1.1' ,
'REQUEST_SCHEME' => 'http' ,
'SERVER_PROTOCOL' => 'HTTP/1.1' ,
'DOCUMENT_ROOT' => '/www/wwwroot/kangbaba.com/webroot' ,
'DOCUMENT_URI' => '/index.php' ,
'REQUEST_URI' => '/indexed?domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_NAME' => '/index.php' ,
'CONTENT_LENGTH' => '' ,
'CONTENT_TYPE' => '' ,
'REQUEST_METHOD' => 'GET' ,
'QUERY_STRING' => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru' ,
'SCRIPT_FILENAME' => '/www/wwwroot/kangbaba.com/webroot/index.php' ,
'FCGI_ROLE' => 'RESPONDER' ,
'PHP_SELF' => '/index.php' ,
'REQUEST_TIME_FLOAT' => (float) 1755663432.6385 ,
'REQUEST_TIME' => (int) 1755663432 ,
'ORIGINAL_REQUEST_METHOD' => 'GET' ,
]
protected base => ''
protected webroot => '/'
protected trustedProxies => [
]
protected _detectors => [
'get' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'GET' ,
] ,
'post' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'POST' ,
] ,
'put' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PUT' ,
] ,
'patch' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'PATCH' ,
] ,
'delete' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'DELETE' ,
] ,
'head' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'HEAD' ,
] ,
'options' => [
'env' => 'REQUEST_METHOD' ,
'value' => 'OPTIONS' ,
] ,
'ssl' => [
'env' => 'HTTPS' ,
'options' => [
'' => [maximum depth reached] ,
] ,
] ,
'ajax' => [
'env' => 'HTTP_X_REQUESTED_WITH' ,
'value' => 'XMLHttpRequest' ,
] ,
'json' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'json' ,
] ,
'xml' => [
'accept' => [
'' => [maximum depth reached] ,
] ,
'param' => '_ext' ,
'value' => 'xml' ,
] ,
'mobile' => object( Closure ) id: 1 {
} ,
'tablet' => object( Closure ) id: 2 {
} ,
]
protected _detectorCache => [
]
protected stream => object( Laminas\Diactoros\PhpInputStream ) id: 3 {
protected resource => (resource) Resource id #174
protected stream => 'php://input'
private cache => ''
private reachedEof => false
}
protected uri => object( Laminas\Diactoros\Uri ) id: 4 {
base => ''
webroot => '/'
protected allowedSchemes => [
'' => [maximum depth reached] ,
]
private scheme => 'https'
private userInfo => ''
private host => 'www.ie0808.com'
private port => null
private path => '/indexed'
private query => 'domain=franks-taallergyspecialtypharmacynetwovika33.ru'
private fragment => ''
private uriString => null
}
protected session => object( Cake\Http\Session ) id: 5 {
protected _engine => null
protected _started => null
protected _lifetime => (int) 259200
protected _isCLI => false
}
protected flash => object( Cake\Http\FlashMessage ) id: 6 {
protected _defaultConfig => [
'' => [maximum depth reached] ,
]
protected session => object( Cake\Http\Session ) id: 5 {}
protected _config => [
'' => [maximum depth reached] ,
]
protected _configInitialized => true
}
protected attributes => [
]
protected emulatedAttributes => [
(int) 0 => 'session' ,
(int) 1 => 'flash' ,
(int) 2 => 'webroot' ,
(int) 3 => 'base' ,
(int) 4 => 'params' ,
(int) 5 => 'here' ,
]
protected uploadedFiles => [
]
protected protocol => null
protected requestTarget => null
}
object( App\Application ) id: 0 {
protected configDir => '/www/wwwroot/kangbaba.com/config/'
protected plugins => object( Cake\Core\PluginCollection ) id: 1 {
protected plugins => [
'' => [maximum depth reached] ,
]
protected names => [
'' => [maximum depth reached] ,
]
protected positions => [
'' => [maximum depth reached] ,
]
protected loopDepth => (int) -1
}
protected controllerFactory => object( Cake\Controller\ControllerFactory ) id: 2 {
protected container => object( Cake\Core\Container ) id: 3 {
}
protected controller => object( App\Controller\HomeController ) id: 4 {
}
}
protected container => object( Cake\Core\Container ) id: 3 {}
protected _eventManager => object( Cake\Event\EventManager ) id: 5 {
'_listeners' => [
]
'_isGlobal' => true
'_trackEvents' => false
'_generalManager' => '(object) EventManager'
'_dispatchedEvents' => null
}
protected _eventClass => 'Cake\Event\Event'
}
// Bind your application to the server.
$server = new Server (new Application ( dirname ( __DIR__ ) . '/config' ));
// Run the request/response through the application and emit the response.
$server -> emit ( $server -> run ());
If you want to customize this error message, create
templates/Error/missing_connection.php